Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.6: Pre-PUA domain [88802] (5 families) this domain is found in association with the PUA domain in the C-terminal region of Archaeosine tRNA-guanine transglycosylase and related stand-alone proteins |
Family d.17.6.4: Hypothetical protein APE0525, N-terminal domain [143004] (1 protein) |
Protein Hypothetical protein APE0525, N-terminal domain [143005] (1 species) |
Species Aeropyrum pernix [TaxId:56636] [143006] (3 PDB entries) Uniprot Q9YEQ6 1-90 |
Domain d2cx1a2: 2cx1 A:1-90 [130968] Other proteins in same PDB: d2cx1a1, d2cx1a3 automated match to d2cx1a2 complexed with tla |
PDB Entry: 2cx1 (more details), 1.8 Å
SCOPe Domain Sequences for d2cx1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cx1a2 d.17.6.4 (A:1-90) Hypothetical protein APE0525, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} mlwarlvglarlearalskkerrsllerlkpyytripfsekadlrlvkartdsgeyeiit vdgvpclfewsdgriyptlqclkafgvdwl
Timeline for d2cx1a2: