Lineage for d2cwvb2 (2cwv B:9-96)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1895674Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1895888Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 1895889Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 1895890Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 1895891Species Arthrobacter globiformis [TaxId:1665] [54421] (40 PDB entries)
    Uniprot P46881 9-628
  8. 1895960Domain d2cwvb2: 2cwv B:9-96 [130950]
    Other proteins in same PDB: d2cwva1, d2cwvb1
    automatically matched to d1av4_2
    complexed with cu

Details for d2cwvb2

PDB Entry: 2cwv (more details), 1.85 Å

PDB Description: Product schiff-base intermediate of copper amine oxidase from arthrobacter globiformis
PDB Compounds: (B:) phenylethylamine oxidase

SCOPe Domain Sequences for d2cwvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cwvb2 d.17.2.1 (B:9-96) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]}
aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs
garpqevtvsvtngtvisaveldtaatg

SCOPe Domain Coordinates for d2cwvb2:

Click to download the PDB-style file with coordinates for d2cwvb2.
(The format of our PDB-style files is described here.)

Timeline for d2cwvb2: