Lineage for d2cwvb1 (2cwv B:212-628)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1782204Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 1782205Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
    automatically mapped to Pfam PF01179
  5. 1782206Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins)
  6. 1782207Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 1782208Species Arthrobacter globiformis [TaxId:1665] [50003] (40 PDB entries)
    Uniprot P46881 9-628
  8. 1782243Domain d2cwvb1: 2cwv B:212-628 [130949]
    Other proteins in same PDB: d2cwva2, d2cwva3, d2cwvb2, d2cwvb3
    automatically matched to d1av4_1
    complexed with cu

Details for d2cwvb1

PDB Entry: 2cwv (more details), 1.85 Å

PDB Description: product schiff-base intermediate of copper amine oxidase from arthrobacter globiformis
PDB Compounds: (B:) phenylethylamine oxidase

SCOPe Domain Sequences for d2cwvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cwvb1 b.30.2.1 (B:212-628) Copper amine oxidase, domain 3 {Arthrobacter globiformis [TaxId: 1665]}
plrttqkpisitqpegpsftvtggnhiewekwsldvgfdvregvvlhniafrdgdrlrpi
inrasiaemvvpygdpspirswqnyfatgeylvgqyanslelgcdclgditylspvisda
fgnpreirngicmheedwgilakhsdlwsginytrrnrrmvisffttignydygfywyly
ldgtiefeakatgvvftsafpeggsdnisqlapglgapfhqhifsarldmaidgftnrve
eedvvrqtmgpgnergnafsrkrtvltreseavreadartgrtwiisnpesknrlnepvg
yklhahnqptlladpgssiarraafatkdlwvtryadderyptgdfvnqhsggaglpsyi
aqdrdidgqdivvwhtfglthfprvedwpimpvdtvgfklrpegffdrspvldvpan

SCOPe Domain Coordinates for d2cwvb1:

Click to download the PDB-style file with coordinates for d2cwvb1.
(The format of our PDB-style files is described here.)

Timeline for d2cwvb1: