SCOP 1.75: Domain d2cwva1: 2cwv A:212-628

Lineage for d2cwva1 (2cwv A:212-628)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.30: Supersandwich [49993] (3 superfamilies)
   sandwich; 18 strands in 2 sheets

4. Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family)

5. Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins)

6. Protein Copper amine oxidase, domain 3 [50000] (4 species)

7. Species Arthrobacter globiformis [TaxId:1665] [50003] (39 PDB entries)
   Uniprot P46881 9-628

8. Domain d2cwva1: 2cwv A:212-628 [130946]
   Other proteins in same PDB: d2cwva2, d2cwva3, d2cwvb2, d2cwvb3
   automatically matched to d1av4_1
   complexed with 2ty, cu; mutant

Details for d2cwva1

PDB Entry: 2cwv, 1.85 Å

PDB Description: product schiff-base intermediate of copper amine oxidase from arthrobacter globiformis

PDB Compounds: (A:) phenylethylamine oxidase

SCOP Domain Sequences for d2cwva1:

Sequence; same for both SEQRES and ATOM records:

>d2cwva1 b.30.2.1 (A:212-628) Copper amine oxidase, domain 3 {Arthrobacter globiformis [TaxId: 1665]}
plrttqkpisitqpegpsftvtggnhiewekwsldvgfdvregvvlhniafrdgdrlrpi
inrasiaemvvpygdpspirswqnyfatgeylvgqyanslelgcdclgditylspvisda
fgnpreirngicmheedwgilakhsdlwsginytrrnrrmvisffttignydygfywyly
ldgtiefeakatgvvftsafpeggsdnisqlapglgapfhqhifsarldmaidgftnrve
eedvvrqtmgpgnergnafsrkrtvltreseavreadartgrtwiisnpesknrlnepvg
yklhahnqptlladpgssiarraafatkdlwvtryadderyptgdfvnqhsggaglpsyi
aqdrdidgqdivvwhtfglthfprvedwpimpvdtvgfklrpegffdrspvldvpan

Timeline for d2cwva1:

• d2cwva1 first appeared in SCOP 1.73
  
• d2cwva1 appears in SCOPe 2.01
  
• d2cwva1 appears in the current release, SCOPe 2.08