SCOP 1.73: Domain d2cwla1: 2cwl A:1-299

Lineage for d2cwla1 (2cwl A:1-299)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.25: Ferritin-like [47239] (4 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (5 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.3: Manganese catalase (T-catalase) [100951] (1 protein)

6. Protein Manganese catalase (T-catalase) [47263] (2 species)

7. Species Thermus thermophilus [TaxId:274] [140444] (1 PDB entry)

8. Domain d2cwla1: 2cwl A:1-299 [130927]

Details for d2cwla1

PDB Entry: 2cwl, 1.65 Å

PDB Description: Crystal structure of manganese-free form of pseudocatalase from Thermus thermophilus HB8

PDB Compounds: (A:) manganese-free pseudocatalase

SCOP Domain Sequences for d2cwla1:

Sequence; same for both SEQRES and ATOM records:

>d2cwla1 a.25.1.3 (A:1-299) Manganese catalase (T-catalase) {Thermus thermophilus [TaxId: 274]}
mflridrlqielpmpkeqdpnaaaavqallggrfgemstlmnymyqsfnfrgkkalkpyy
dlianiateelghielvaatinsllaknpgkdleegvdpesaplgfakdvrnaahfiagg
anslvmgamgehwngeyvftsgnlildllhnfflevaarthklrvyemtdnpvaremigy
llvrggvhaaaygkalesltgvemtkmlpipkidnskipeakkymdlgfhrnlyrfsped
yrdlgliwkgaspedgtevvvvdgpptggpvfdaghdaaefapefhpgelyeiakklye

Timeline for d2cwla1:

• d2cwla1 is new in SCOP 1.73
  
• d2cwla1 appears in SCOP 1.75
  
• d2cwla1 appears in the current release, SCOPe 2.08