Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.1: YjgF-like [55298] (2 families) forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
Family d.79.1.1: YjgF/L-PSP [55299] (11 proteins) some members possess an endoribonuclease activity inhibiting mRNA translation |
Protein Putative translation intiation inhibitor TTHA0137 [143529] (1 species) |
Species Thermus thermophilus [TaxId:274] [143530] (3 PDB entries) Uniprot Q5SM06 1-124 |
Domain d2cw4a1: 2cw4 A:1-124 [130919] automatically matched to 2CSL A:1-124 |
PDB Entry: 2cw4 (more details), 1.8 Å
SCOP Domain Sequences for d2cw4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cw4a1 d.79.1.1 (A:1-124) Putative translation intiation inhibitor TTHA0137 {Thermus thermophilus [TaxId: 274]} meavktdrapaaigpyaqavkaggfvfvsgqiplapdgslvegdirvqtervmenlkavl eaagsglsrvvqttcfladmedfpgfnevyaryftppyparatvavkalprgvrvevacv alae
Timeline for d2cw4a1: