SCOP 1.75: Domain d2cw4a1: 2cw4 A:1-124

Lineage for d2cw4a1 (2cw4 A:1-124)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.1: YjgF-like [55298] (2 families)
   forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.1.1: YjgF/L-PSP [55299] (11 proteins)
   some members possess an endoribonuclease activity inhibiting mRNA translation

6. Protein Putative translation intiation inhibitor TTHA0137 [143529] (1 species)

7. Species Thermus thermophilus [TaxId:274] [143530] (3 PDB entries)
   Uniprot Q5SM06 1-124

8. Domain d2cw4a1: 2cw4 A:1-124 [130919]
   automatically matched to 2CSL A:1-124

Details for d2cw4a1

PDB Entry: 2cw4, 1.8 Å

PDB Description: Crystal structure of TTHA0137 from Thermus Thermophilus HB8

PDB Compounds: (A:) translation initiation inhibitor

SCOP Domain Sequences for d2cw4a1:

Sequence; same for both SEQRES and ATOM records:

>d2cw4a1 d.79.1.1 (A:1-124) Putative translation intiation inhibitor TTHA0137 {Thermus thermophilus [TaxId: 274]}
meavktdrapaaigpyaqavkaggfvfvsgqiplapdgslvegdirvqtervmenlkavl
eaagsglsrvvqttcfladmedfpgfnevyaryftppyparatvavkalprgvrvevacv
alae

Timeline for d2cw4a1:

• d2cw4a1 first appeared in SCOP 1.73
  
• d2cw4a1 is called d2cw4a_ in SCOPe 2.01
  
• d2cw4a1 appears in the current release, SCOPe 2.08, called d2cw4a_