SCOPe 2.06: Domain d2cw0b2: 2cw0 B:50-172

Lineage for d2cw0b2 (2cw0 B:50-172)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
   unusual fold; contains a left-handed beta-alpha-beta unit

4. Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family)
   automatically mapped to Pfam PF01000

5. Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)

6. Protein RNA polymerase alpha subunit [56555] (3 species)

7. Species Thermus thermophilus [TaxId:274] [75595] (15 PDB entries)
   Uniprot Q9Z9H6; part of multichain biological unit

8. Domain d2cw0b2: 2cw0 B:50-172 [130901]
   Other proteins in same PDB: d2cw0a1, d2cw0b1, d2cw0c1, d2cw0d1, d2cw0e1, d2cw0f1, d2cw0f2, d2cw0f3, d2cw0k1, d2cw0l1, d2cw0m1, d2cw0n1, d2cw0o1, d2cw0p1, d2cw0p2, d2cw0p3
   automatically matched to d1iw7a2
   complexed with mg, zn

Details for d2cw0b2

PDB Entry: 2cw0, 3.3 Å

PDB Description: crystal structure of thermus thermophilus rna polymerase holoenzyme at 3.3 angstroms resolution

PDB Compounds: (B:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d2cw0b2:

Sequence; same for both SEQRES and ATOM records:

>d2cw0b2 d.181.1.1 (B:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

Timeline for d2cw0b2:

• d2cw0b2 first appeared in SCOP 1.73
  
• d2cw0b2 appears in SCOPe 2.05
  
• d2cw0b2 appears in SCOPe 2.07
  
• d2cw0b2 appears in the current release, SCOPe 2.08