Lineage for d2cw0a1 (2cw0 A:1-49,A:173-229)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2200525Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2200656Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 2200657Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)
  6. 2200658Protein RNA polymerase alpha [55259] (3 species)
  7. 2200673Species Thermus thermophilus [TaxId:274] [75478] (15 PDB entries)
    Uniprot Q9Z9H6; part of multichain biological unit
  8. 2200726Domain d2cw0a1: 2cw0 A:1-49,A:173-229 [130898]
    Other proteins in same PDB: d2cw0a2, d2cw0b2, d2cw0c1, d2cw0d1, d2cw0e1, d2cw0f1, d2cw0f2, d2cw0f3, d2cw0k2, d2cw0l2, d2cw0m1, d2cw0n1, d2cw0o1, d2cw0p1, d2cw0p2, d2cw0p3
    automatically matched to d1iw7a1
    complexed with mg, zn

Details for d2cw0a1

PDB Entry: 2cw0 (more details), 3.3 Å

PDB Description: crystal structure of thermus thermophilus rna polymerase holoenzyme at 3.3 angstroms resolution
PDB Compounds: (A:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d2cw0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cw0a1 d.74.3.1 (A:1-49,A:173-229) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]}
mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve
dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq

SCOPe Domain Coordinates for d2cw0a1:

Click to download the PDB-style file with coordinates for d2cw0a1.
(The format of our PDB-style files is described here.)

Timeline for d2cw0a1: