Lineage for d2cvdd2 (2cvd D:2-75)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 699243Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 699636Protein Class sigma GST [81362] (5 species)
  7. 699649Species Human (Homo sapiens) [TaxId:9606] [89705] (4 PDB entries)
    synonym: hematopoietic prostaglandin D synthase
  8. 699653Domain d2cvdd2: 2cvd D:2-75 [130868]
    Other proteins in same PDB: d2cvda1, d2cvdb1, d2cvdc1, d2cvdd1
    automatically matched to d1iyha2
    complexed with gol, gsh, hql, mg

Details for d2cvdd2

PDB Entry: 2cvd (more details), 1.45 Å

PDB Description: Crystal structure analysis of human hematopoietic prostaglandin D synthase complexed with HQL-79
PDB Compounds: (D:) glutathione-requiring prostaglandin d synthase

SCOP Domain Sequences for d2cvdd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cvdd2 c.47.1.5 (D:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltknt

SCOP Domain Coordinates for d2cvdd2:

Click to download the PDB-style file with coordinates for d2cvdd2.
(The format of our PDB-style files is described here.)

Timeline for d2cvdd2: