Lineage for d2cv5d1 (2cv5 D:27-122)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 909266Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 909267Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 909268Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 909345Protein Histone H2B [47119] (6 species)
  7. 909412Species Human (Homo sapiens), H2B.k [TaxId:9606] [140394] (1 PDB entry)
    Uniprot O60814 30-125
  8. 909413Domain d2cv5d1: 2cv5 D:27-122 [130850]
    Other proteins in same PDB: d2cv5a_, d2cv5b1, d2cv5c1, d2cv5e_, d2cv5f1, d2cv5g1
    protein/DNA complex; complexed with cl, mn

Details for d2cv5d1

PDB Entry: 2cv5 (more details), 2.5 Å

PDB Description: Crystal structure of human nucleosome core particle
PDB Compounds: (D:) Histone H2B K

SCOPe Domain Sequences for d2cv5d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cv5d1 a.22.1.1 (D:27-122) Histone H2B {Human (Homo sapiens), H2B.k [TaxId: 9606]}
krsrkesysvyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrsti
tsreiqtavrlllpgelakhavsegtkavtkytsak

SCOPe Domain Coordinates for d2cv5d1:

Click to download the PDB-style file with coordinates for d2cv5d1.
(The format of our PDB-style files is described here.)

Timeline for d2cv5d1: