Lineage for d2cv0a1 (2cv0 A:306-468)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721147Fold a.97: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48162] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2721148Superfamily a.97.1: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48163] (3 families) (S)
  5. 2721149Family a.97.1.1: C-terminal domain of glutamyl-tRNA synthetase (GluRS) [48164] (1 protein)
  6. 2721150Protein C-terminal domain of glutamyl-tRNA synthetase (GluRS) [48165] (1 species)
  7. 2721151Species Thermus thermophilus [TaxId:274] [48166] (11 PDB entries)
  8. 2721159Domain d2cv0a1: 2cv0 A:306-468 [130824]
    Other proteins in same PDB: d2cv0a2, d2cv0b2
    automatically matched to d1g59a1
    protein/RNA complex; complexed with glu, mg

Details for d2cv0a1

PDB Entry: 2cv0 (more details), 2.4 Å

PDB Description: Glutamyl-tRNA synthetase from Thermus thermophilus in complex with tRNA(Glu) and L-glutamate
PDB Compounds: (A:) Glutamyl-tRNA synthetase

SCOPe Domain Sequences for d2cv0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cv0a1 a.97.1.1 (A:306-468) C-terminal domain of glutamyl-tRNA synthetase (GluRS) {Thermus thermophilus [TaxId: 274]}
dleklrwmngkyirevlsleevaervkpflreaglsweseaylrravelmrprfdtlkef
pekarylftedypvsekaqrkleeglpllkelyprlraqeewteaaleallrgfaaekgv
klgqvaqplraaltgsletpglfeilallgkeralrrlerala

SCOPe Domain Coordinates for d2cv0a1:

Click to download the PDB-style file with coordinates for d2cv0a1.
(The format of our PDB-style files is described here.)

Timeline for d2cv0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cv0a2