Lineage for d2cuia1 (2cui A:6-106)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1521239Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1521240Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1521671Protein Tenascin-X [141045] (1 species)
  7. 1521672Species Human (Homo sapiens) [TaxId:9606] [141046] (3 PDB entries)
    Uniprot P22105 3699-3798! Uniprot P22105 3890-3991! Uniprot P22105 3977-4069
  8. 1521674Domain d2cuia1: 2cui A:6-106 [130811]

Details for d2cuia1

PDB Entry: 2cui (more details)

PDB Description: solution structure of the 31st fibronectin type iii domain of the human tenascin x
PDB Compounds: (A:) Tenascin-X

SCOPe Domain Sequences for d2cuia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]}
sgsrprlsqlsvtdvttsslrlnweappgafdsfllrfgvpspstlephprpllqrelmv
pgtrhsavlrdlrsgtlysltlyglrgphkadsiqgtartl

SCOPe Domain Coordinates for d2cuia1:

Click to download the PDB-style file with coordinates for d2cuia1.
(The format of our PDB-style files is described here.)

Timeline for d2cuia1: