SCOPe 2.06: Domain d2cuha1: 2cuh A:8-109

Lineage for d2cuha1 (2cuh A:8-109)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Tenascin-X [141045] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141046] (3 PDB entries)
   Uniprot P22105 3699-3798! Uniprot P22105 3890-3991! Uniprot P22105 3977-4069

8. Domain d2cuha1: 2cuh A:8-109 [130810]
   Other proteins in same PDB: d2cuha2, d2cuha3

Details for d2cuha1

PDB Entry: 2cuh

PDB Description: solution structure of the 31st fibronectin type iii domain of the human tenascin x

PDB Compounds: (A:) Tenascin-X

SCOPe Domain Sequences for d2cuha1:

Sequence; same for both SEQRES and ATOM records:

>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]}
pdgptqlralnltegfavlhwkppqnpvdtydiqvtapgapplqaetpgsavdyplhdlv
lhtnytatvrglrgpnltspasitfttgleaprdleakevtp

Timeline for d2cuha1:

• d2cuha1 first appeared in SCOP 1.73
  
• d2cuha1 appears in SCOPe 2.05
  
• d2cuha1 appears in SCOPe 2.07
  
• d2cuha1 appears in the current release, SCOPe 2.08