SCOPe 2.07: Domain d2cu1a1: 2cu1 A:8-97

Lineage for d2cu1a1 (2cu1 A:8-97)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.2: CAD & PB1 domains [54277] (3 families)
   contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily

5. Family d.15.2.2: PB1 domain [64225] (11 proteins)
   Pfam PF00564
   forms heterodimers, although not all PB1 domain pairs associate.

6. Protein Mitogen-activated protein kinase kinase kinase 2, MEKK 2 [142976] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142977] (2 PDB entries)
   Uniprot Q9Y2U5 42-123! Uniprot Q9Y2U5 43-132

8. Domain d2cu1a1: 2cu1 A:8-97 [130802]
   Other proteins in same PDB: d2cu1a2, d2cu1a3

Details for d2cu1a1

PDB Entry: 2cu1

PDB Description: solution structure of the pb1 domain of human protein kinase mekk2b

PDB Compounds: (A:) Mitogen-activated protein kinase kinase kinase 2

SCOPe Domain Sequences for d2cu1a1:

Sequence; same for both SEQRES and ATOM records:

>d2cu1a1 d.15.2.2 (A:8-97) Mitogen-activated protein kinase kinase kinase 2, MEKK 2 {Human (Homo sapiens) [TaxId: 9606]}
dvrvkfehrgekrilqfprpvkledlrskakiafgqsmdlhytnnelviplttqddldka
velldrsihmkslkillvingstqatnlep

Timeline for d2cu1a1:

• d2cu1a1 first appeared in SCOP 1.73
  
• d2cu1a1 appears in SCOPe 2.06
  
• d2cu1a1 appears in the current release, SCOPe 2.08