Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.2: CAD & PB1 domains [54277] (3 families) contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily |
Family d.15.2.2: PB1 domain [64225] (11 proteins) Pfam PF00564 forms heterodimers, although not all PB1 domain pairs associate. |
Protein Mitogen-activated protein kinase kinase kinase 2, MEKK 2 [142976] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [142977] (2 PDB entries) Uniprot Q9Y2U5 42-123! Uniprot Q9Y2U5 43-132 |
Domain d2cu1a1: 2cu1 A:8-97 [130802] |
PDB Entry: 2cu1 (more details)
SCOPe Domain Sequences for d2cu1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cu1a1 d.15.2.2 (A:8-97) Mitogen-activated protein kinase kinase kinase 2, MEKK 2 {Human (Homo sapiens) [TaxId: 9606]} dvrvkfehrgekrilqfprpvkledlrskakiafgqsmdlhytnnelviplttqddldka velldrsihmkslkillvingstqatnlep
Timeline for d2cu1a1: