Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) |
Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins) contain additional N-terminal strand "0", antiparallel to strand 2 |
Protein Acetate-CoA ligase alpha chain, AcdA, domains 2 and 3 [142043] (1 species) duplication: tandem repeat of two similar domains, structurally and functionally related to the C-terminal domains of Succinyl-CoA synthetase subunits; the first domain (2) is related to the alpha-chain domain, whereas the second domain (3) is related to the beta-chain domain |
Species Pyrococcus horikoshii [TaxId:53953] [142044] (1 PDB entry) Uniprot O58493 130-290! Uniprot O58493 291-453 PH0766 |
Domain d2csub2: 2csu B:130-290 [130785] Other proteins in same PDB: d2csua1, d2csub1 automated match to d2csua2 |
PDB Entry: 2csu (more details), 2.2 Å
SCOPe Domain Sequences for d2csub2:
Sequence, based on SEQRES records: (download)
>d2csub2 c.23.4.1 (B:130-290) Acetate-CoA ligase alpha chain, AcdA, domains 2 and 3 {Pyrococcus horikoshii [TaxId: 53953]} vgimnthvdlnatfitvakkgnvafisqsgalgagivyktikedigfskfisvgnmadvd faelmeyladteedkaialyiegvrngkkfmevakrvtkkkpiialkagksesgaraass htgslagswkiyeaafkqsgvlvantidemlsmarafsqpl
>d2csub2 c.23.4.1 (B:130-290) Acetate-CoA ligase alpha chain, AcdA, domains 2 and 3 {Pyrococcus horikoshii [TaxId: 53953]} vgimnthvdlnatfitvakkgnvafisqsgalgagivyktikedigfskfisvgnmadvd faelmeyladteedkaialyiegvrngkkfmevakrvtkkkpiialkagkkiyeaafkqs gvlvantidemlsmarafsqpl
Timeline for d2csub2: