SCOPe 2.01: Domain d2csub1: 2csu B:1-129

Lineage for d2csub1 (2csu B:1-129)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.8: CoA-binding domain [51900] (6 proteins)

6. Protein Acetate-CoA ligase alpha chain, AcdA, N-terminal domain [141936] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [141937] (1 PDB entry)
   Uniprot O58493 1-129

8. Domain d2csub1: 2csu B:1-129 [130784]
   Other proteins in same PDB: d2csua2, d2csua3, d2csub2, d2csub3
   automatically matched to 2CSU A:1-129

Details for d2csub1

PDB Entry: 2csu, 2.2 Å

PDB Description: Crystal structure of PH0766 from Pyrococcus horikoshii OT3

PDB Compounds: (B:) 457aa long hypothetical protein

SCOPe Domain Sequences for d2csub1:

Sequence; same for both SEQRES and ATOM records:

>d2csub1 c.2.1.8 (B:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
mldyffnpkgiavigasndpkklgyevfknlkeykkgkvypvnikeeevqgvkayksvkd
ipdeidlaiivvpkrfvkdtliqcgekgvkgvviitagfgetgeegkreekelveiahky
gmriigpnc

Timeline for d2csub1:

• d2csub1 first appeared in SCOP 1.73
  
• d2csub1 appears in SCOP 1.75
  
• d2csub1 appears in SCOPe 2.02
  
• d2csub1 appears in the current release, SCOPe 2.08