Lineage for d2csba4 (2csb A:465-519)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 770823Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 770939Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) (S)
    duplication: contains two helix-hairpin-helix (HhH) motifs
  5. 770975Family a.60.2.4: Topoisomerase V repeat domain [140626] (1 protein)
    this is a repeat family; one repeat unit is 2csb A:351-409 found in domain
  6. 770976Protein Topoisomerase V [140627] (1 species)
  7. 770977Species Methanopyrus kandleri [TaxId:2320] [140628] (1 PDB entry)
    Uniprot Q977W1 294-350! Uniprot Q977W1 351-409! Uniprot Q977W1 410-464! Uniprot Q977W1 465-519
  8. 770981Domain d2csba4: 2csb A:465-519 [130754]
    Other proteins in same PDB: d2csba5
    4th repeat
    complexed with mg

Details for d2csba4

PDB Entry: 2csb (more details), 2.3 Å

PDB Description: crystal structure of topoisomerase v from methanopyrus kandleri (61 kda fragment)
PDB Compounds: (A:) Topoisomerase V

SCOP Domain Sequences for d2csba4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2csba4 a.60.2.4 (A:465-519) Topoisomerase V {Methanopyrus kandleri [TaxId: 2320]}
pgyaslisirgidreraerllkkyggyskvreagveelredgltdaqirelkglk

SCOP Domain Coordinates for d2csba4:

Click to download the PDB-style file with coordinates for d2csba4.
(The format of our PDB-style files is described here.)

Timeline for d2csba4: