SCOPe 2.06: Domain d2crua1: 2cru A:8-112

Lineage for d2crua1 (2cru A:8-112)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.6: Double-stranded DNA-binding domain [46950] (1 family)
   automatically mapped to Pfam PF01984

5. Family a.5.6.1: Double-stranded DNA-binding domain [46951] (2 proteins)

6. Protein Programmed cell death protein 5 [140348] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140349] (1 PDB entry)
   Uniprot O14737 8-112

8. Domain d2crua1: 2cru A:8-112 [130742]
   Other proteins in same PDB: d2crua2, d2crua3

Details for d2crua1

PDB Entry: 2cru

PDB Description: solution structure of programmed cell death 5

PDB Compounds: (A:) Programmed cell death protein 5

SCOPe Domain Sequences for d2crua1:

Sequence; same for both SEQRES and ATOM records:

>d2crua1 a.5.6.1 (A:8-112) Programmed cell death protein 5 {Human (Homo sapiens) [TaxId: 9606]}
lrrqrlaelqakhgdpgdaaqqeakhreaemrnsilaqvldqsararlsnlalvkpektk
avenyliqmarygqlsekvseqglieilkkvsqqtektttvkfnr

Timeline for d2crua1:

• d2crua1 first appeared in SCOP 1.73
  
• d2crua1 appears in SCOPe 2.05
  
• d2crua1 appears in SCOPe 2.07
  
• d2crua1 appears in the current release, SCOPe 2.08