Lineage for d2cqpa1 (2cqp A:917-1002)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908439Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1908690Protein RNA-binding protein 12 [143349] (2 species)
    3rd RBD
  7. 1908695Species Mouse (Mus musculus) [TaxId:10090] [143351] (1 PDB entry)
    Uniprot Q8R4X3 917-1002
  8. 1908696Domain d2cqpa1: 2cqp A:917-1002 [130727]
    C-terminal (4th) RBD

Details for d2cqpa1

PDB Entry: 2cqp (more details)

PDB Description: Solution structure of the RNA binding domain of RNA-binding protein 12
PDB Compounds: (A:) RNA-binding protein 12

SCOPe Domain Sequences for d2cqpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]}
gassgkpgptiikvqnmpftvsideildffygyqvipgsvclkynekgmptgeamvafes
rdeataavidlndrpigsrkvklvlg

SCOPe Domain Coordinates for d2cqpa1:

Click to download the PDB-style file with coordinates for d2cqpa1.
(The format of our PDB-style files is described here.)

Timeline for d2cqpa1: