Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
Protein IGF-II mRNA-binding protein 2 isoform A [143344] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [143345] (1 PDB entry) Uniprot Q9Y6M1 2-81 |
Domain d2cqha1: 2cqh A:2-81 [130723] Other proteins in same PDB: d2cqha2, d2cqha3 1st RBD |
PDB Entry: 2cqh (more details)
SCOPe Domain Sequences for d2cqha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} mnklyignlspavtaddlrqlfgdrklplagqvllksgyafvdypdqnwairaietlsgk velhgkimevdysvskklrs
Timeline for d2cqha1: