Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) |
Family d.58.7.1: Canonical RBD [54929] (67 proteins) |
Protein TAR DNA-binding protein 43, TDP-43 [117957] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117958] (2 PDB entries) |
Domain d2cqga1: 2cqg A:96-185 [130722] |
PDB Entry: 2cqg (more details)
SCOP Domain Sequences for d2cqga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} vkravqktsdlivlglpwktteqdlkeyfstfgevlmvqvkkdlktghskgfgfvrftey etqvkvmsqrhmidgrwcdcklpnskqsqd
Timeline for d2cqga1: