Lineage for d2cqga1 (2cqg A:96-185)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724300Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) (S)
  5. 724301Family d.58.7.1: Canonical RBD [54929] (67 proteins)
  6. 724652Protein TAR DNA-binding protein 43, TDP-43 [117957] (1 species)
  7. 724653Species Human (Homo sapiens) [TaxId:9606] [117958] (2 PDB entries)
  8. 724654Domain d2cqga1: 2cqg A:96-185 [130722]

Details for d2cqga1

PDB Entry: 2cqg (more details)

PDB Description: solution structure of the rna binding domain of tar dna-binding protein-43
PDB Compounds: (A:) TAR DNA-binding protein-43

SCOP Domain Sequences for d2cqga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]}
vkravqktsdlivlglpwktteqdlkeyfstfgevlmvqvkkdlktghskgfgfvrftey
etqvkvmsqrhmidgrwcdcklpnskqsqd

SCOP Domain Coordinates for d2cqga1:

Click to download the PDB-style file with coordinates for d2cqga1.
(The format of our PDB-style files is described here.)

Timeline for d2cqga1: