Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
Protein RNA-binding protein 41, RBM41 [143296] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [143297] (1 PDB entry) Uniprot Q96IZ5 291-392 |
Domain d2cpxa1: 2cpx A:291-392 [130708] Other proteins in same PDB: d2cpxa2, d2cpxa3 |
PDB Entry: 2cpx (more details)
SCOPe Domain Sequences for d2cpxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} eeirkipmfssynpgepnkvlylknlsprvterdlvslfarfqekkgppiqfrmmtgrmr gqafitfpnkeiawqalhlvngyklygkilviefgknkkqrs
Timeline for d2cpxa1: