Lineage for d2cpha1 (2cph A:454-547)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195050Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2195051Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 2195277Protein Probable RNA-binding protein 19, Rbm19 [117969] (1 species)
  7. 2195278Species Mouse (Mus musculus) [TaxId:10090] [117970] (4 PDB entries)
    Uniprot Q8R3C6 399-484; 581-678
  8. 2195280Domain d2cpha1: 2cph A:454-547 [130700]
    Other proteins in same PDB: d2cpha2, d2cpha3

Details for d2cpha1

PDB Entry: 2cph (more details)

PDB Description: solution structure of the c-terminal rna recognition motif of hypothetical rna-binding protein rbm19
PDB Compounds: (A:) RNA binding motif protein 19

SCOPe Domain Sequences for d2cpha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}
qvpkkqttskilvrnipfqanqreirelfstfgelktvrlpkkmtgtgahrgfgfvdfit
kqdakkafnalchsthlygrrlvlewadsevtvq

SCOPe Domain Coordinates for d2cpha1:

Click to download the PDB-style file with coordinates for d2cpha1.
(The format of our PDB-style files is described here.)

Timeline for d2cpha1: