Lineage for d2cpea1 (2cpe A:353-453)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195050Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2195051Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 2195331Protein RNA-binding protein EWS [143340] (1 species)
  7. 2195332Species Human (Homo sapiens) [TaxId:9606] [143341] (1 PDB entry)
    Uniprot Q01844 353-453
  8. 2195333Domain d2cpea1: 2cpe A:353-453 [130698]
    Other proteins in same PDB: d2cpea2, d2cpea3

Details for d2cpea1

PDB Entry: 2cpe (more details)

PDB Description: solution structure of the rna recognition motif of ewing sarcoma(ews) protein
PDB Compounds: (A:) RNA-binding protein EWS

SCOPe Domain Sequences for d2cpea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]}
dpdedsdnsaiyvqglndsvtlddladffkqcgvvkmnkrtgqpmihiyldketgkpkgd
atvsyedpptakaavewfdgkdfqgsklkvslarkkppmns

SCOPe Domain Coordinates for d2cpea1:

Click to download the PDB-style file with coordinates for d2cpea1.
(The format of our PDB-style files is described here.)

Timeline for d2cpea1: