SCOPe 2.02: Domain d2cnia1: 2cni A:3-299

Lineage for d2cnia1 (2cni A:3-299)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein Tyrosine phosphatase [52806] (7 species)

7. Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (97 PDB entries)
   Uniprot P18031 2-300 ! Uniprot P18031 1-298 ! Uniprot P18031 2-299

8. Domain d2cnia1: 2cni A:3-299 [130644]
   automatically matched to d1q1ma_
   complexed with izf, mg

Details for d2cnia1

PDB Entry: 2cni, 2 Å

PDB Description: structural insights into the design of nonpeptidic isothiazolidinone- containing inhibitors of protein tyrosine phosphatase 1b

PDB Compounds: (A:) tyrosine-protein phosphatase non-receptor type 1

SCOPe Domain Sequences for d2cnia1:

Sequence; same for both SEQRES and ATOM records:

>d2cnia1 c.45.1.2 (A:3-299) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]}
mekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhqe
dndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkca
qywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpdf
gvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdps
svdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshedl

Timeline for d2cnia1:

• d2cnia1 first appeared in SCOP 1.73
  
• d2cnia1 appears in SCOPe 2.01
  
• d2cnia1 is called d2cnia_ in SCOPe 2.03
  
• d2cnia1 appears in the current release, SCOPe 2.08, called d2cnia_