SCOP 1.73: Domain d2cnga1: 2cng A:3-299

Lineage for d2cnga1 (2cng A:3-299)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (5 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (6 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein Tyrosine phosphatase [52806] (7 species)

7. Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (91 PDB entries)

8. Domain d2cnga1: 2cng A:3-299 [130642]
   automatically matched to d1q1ma_
   complexed with gol, ize, mg

Details for d2cnga1

PDB Entry: 2cng, 1.9 Å

PDB Description: structural insights into the design of nonpeptidic isothiazolidinone- containing inhibitors of protein tyrosine phosphatase 1b

PDB Compounds: (A:) tyrosine-protein phosphatase non-receptor type 1

SCOP Domain Sequences for d2cnga1:

Sequence; same for both SEQRES and ATOM records:

>d2cnga1 c.45.1.2 (A:3-299) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]}
mekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhqe
dndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkca
qywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpdf
gvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdps
svdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshedl

Timeline for d2cnga1:

• d2cnga1 is new in SCOP 1.73
  
• d2cnga1 appears in SCOP 1.75
  
• d2cnga1 appears in the current release, SCOPe 2.08, called d2cnga_