Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (4 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88606] (89 PDB entries) Uniprot P01901 22-299 |
Domain d2clzh1: 2clz H:182-274 [130606] Other proteins in same PDB: d2clza2, d2clzb1, d2clzh2, d2clzp1 automatically matched to d1ddha1 mutant |
PDB Entry: 2clz (more details), 1.9 Å
SCOP Domain Sequences for d2clzh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2clzh1 b.1.1.2 (H:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf qkwasvvvplgkeqyytchvyhqglpepltlrw
Timeline for d2clzh1:
View in 3D Domains from other chains: (mouse over for more information) d2clza1, d2clza2, d2clzb1, d2clzp1 |