Lineage for d2clvb_ (2clv B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 931882Protein beta2-microglobulin [88600] (5 species)
  7. 932374Species Mouse (Mus musculus) [TaxId:10090] [88603] (142 PDB entries)
    Uniprot P01887
  8. 932406Domain d2clvb_: 2clv B: [130592]
    Other proteins in same PDB: d2clva1, d2clva2, d2clvh1, d2clvh2
    automated match to d1bz9b_
    mutant

Details for d2clvb_

PDB Entry: 2clv (more details), 1.9 Å

PDB Description: mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and pbm8 peptide
PDB Compounds: (B:) beta-2 microglobulin

SCOPe Domain Sequences for d2clvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2clvb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d2clvb_:

Click to download the PDB-style file with coordinates for d2clvb_.
(The format of our PDB-style files is described here.)

Timeline for d2clvb_: