![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein beta2-microglobulin [88600] (4 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88603] (85 PDB entries) |
![]() | Domain d2clvb1: 2clv B:1-99 [130592] Other proteins in same PDB: d2clva1, d2clva2, d2clvh1, d2clvh2 automatically matched to d1bz9b_ mutant |
PDB Entry: 2clv (more details), 1.9 Å
SCOP Domain Sequences for d2clvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2clvb1 b.1.1.2 (B:1-99) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d2clvb1: