SCOPe 2.01: Domain d2cllb_: 2cll B:

Lineage for d2cllb_ (2cll B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)

6. Protein automated matches [190054] (7 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:90371] [189633] (14 PDB entries)

8. Domain d2cllb_: 2cll B: [130581]
   Other proteins in same PDB: d2clla_
   automated match to d2tysb_
   complexed with f9f, na, pls

Details for d2cllb_

PDB Entry: 2cll, 1.6 Å

PDB Description: tryptophan synthase (external aldimine state) in complex with n-(4'-trifluoromethoxybenzenesulfonyl)-2-amino-1-ethylphosphate (f9)

PDB Compounds: (B:) tryptophan synthase beta chain

SCOPe Domain Sequences for d2cllb_:

Sequence; same for both SEQRES and ATOM records:

>d2cllb_ c.79.1.1 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdilkarg

Timeline for d2cllb_:

• d2cllb_ first appeared in SCOP 1.73, called d2cllb1
  
• d2cllb_ was called d2cllb1 in SCOP 1.75
  
• d2cllb_ appears in SCOPe 2.02
  
• d2cllb_ appears in the current release, SCOPe 2.08