Lineage for d2cj5a_ (2cj5 A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 912955Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 913191Superfamily a.29.6: Plant invertase/pectin methylesterase inhibitor [101148] (2 families) (S)
    contains a short alpha-hairpin at the N-terminal extension
  5. 913192Family a.29.6.1: Plant invertase/pectin methylesterase inhibitor [101149] (3 proteins)
    Pfam PF04043
  6. 913208Protein automated matches [190250] (1 species)
    not a true protein
  7. 913209Species Tobacco (Nicotiana tabacum) [TaxId:4097] [187032] (6 PDB entries)
  8. 913213Domain d2cj5a_: 2cj5 A: [130520]
    automated match to d1rj1a_
    complexed with act, so4

Details for d2cj5a_

PDB Entry: 2cj5 (more details), 1.84 Å

PDB Description: crystal structure of a cell wall invertase inhibitor from tobacco (ph 5.0)
PDB Compounds: (A:) invertase inhibitor

SCOPe Domain Sequences for d2cj5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cj5a_ a.29.6.1 (A:) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
nnlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisklrhs
nppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceeyfkg
skspfsalniavhelsdvgraivrnll

SCOPe Domain Coordinates for d2cj5a_:

Click to download the PDB-style file with coordinates for d2cj5a_.
(The format of our PDB-style files is described here.)

Timeline for d2cj5a_: