Class a: All alpha proteins [46456] (258 folds) |
Fold a.29: Bromodomain-like [47363] (10 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.6: Plant invertase/pectin methylesterase inhibitor [101148] (1 family) contains a short alpha-hairpin at the N-terminal extension |
Family a.29.6.1: Plant invertase/pectin methylesterase inhibitor [101149] (2 proteins) Pfam PF04043 |
Protein Invertase inhibitor [101150] (1 species) |
Species Common tobacco (Nicotiana tabacum) [TaxId:4097] [101151] (7 PDB entries) |
Domain d2cj4a1: 2cj4 A:4-150 [130518] automatically matched to d1rj1a_ complexed with act, so4 |
PDB Entry: 2cj4 (more details), 1.63 Å
SCOP Domain Sequences for d2cj4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cj4a1 a.29.6.1 (A:4-150) Invertase inhibitor {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} nnlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisklrhs nppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceeyfkg skspfsalniavhelsdvgraivrnll
Timeline for d2cj4a1: