SCOP 1.75: Domain d2ciia2: 2cii A:3-180

Lineage for d2ciia2 (2cii A:3-180)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)

7. Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (21 PDB entries)

8. Domain d2ciia2: 2cii A:3-180 [130491]
   Other proteins in same PDB: d2ciia1, d2ciib1
   automatically matched to d1ddha2
   complexed with gol

Details for d2ciia2

PDB Entry: 2cii, 2.55 Å

PDB Description: the crystal structure of h-2db complexed with a partial peptide epitope suggests an mhc class i assembly-intermediate

PDB Compounds: (A:) h-2 class I histocompatibility antigen d-b alpha chain

SCOP Domain Sequences for d2ciia2:

Sequence; same for both SEQRES and ATOM records:

>d2ciia2 d.19.1.1 (A:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
hsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywer
etqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegrd
yialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll

Timeline for d2ciia2:

• d2ciia2 first appeared in SCOP 1.73
  
• d2ciia2 appears in SCOPe 2.01
  
• d2ciia2 appears in the current release, SCOPe 2.08