| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
| Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species) |
| Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (15 PDB entries) |
| Domain d2ciia2: 2cii A:3-180 [130491] Other proteins in same PDB: d2ciia1, d2ciib1 automatically matched to d1ddha2 complexed with gol |
PDB Entry: 2cii (more details), 2.55 Å
SCOP Domain Sequences for d2ciia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ciia2 d.19.1.1 (A:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
hsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywer
etqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegrd
yialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
Timeline for d2ciia2: