SCOPe 2.07: Domain d2ciia1: 2cii A:182-274

Lineage for d2ciia1 (2cii A:182-274)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (110 PDB entries)
   Uniprot P01901 22-299

8. Domain d2ciia1: 2cii A:182-274 [130490]
   Other proteins in same PDB: d2ciia2, d2ciib_
   automatically matched to d1ddha1
   complexed with gol

Details for d2ciia1

PDB Entry: 2cii, 2.55 Å

PDB Description: the crystal structure of h-2db complexed with a partial peptide epitope suggests an mhc class i assembly-intermediate

PDB Compounds: (A:) h-2 class I histocompatibility antigen d-b alpha chain

SCOPe Domain Sequences for d2ciia1:

Sequence; same for both SEQRES and ATOM records:

>d2ciia1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwalngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrw

Timeline for d2ciia1:

• d2ciia1 first appeared in SCOP 1.73
  
• d2ciia1 appears in SCOPe 2.06
  
• d2ciia1 appears in the current release, SCOPe 2.08