Lineage for d2cica1 (2cic A:1-229)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 780087Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
    multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer
  4. 780088Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (4 families) (S)
    basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat
  5. 780089Family a.204.1.1: Type II deoxyuridine triphosphatase [101387] (1 protein)
    one subunit comprises two degenerate structural repeats, organised into the "rigid" and "mobile" subdomains
  6. 780090Protein Type II deoxyuridine triphosphatase [101388] (2 species)
  7. 780091Species Campylobacter jejuni [TaxId:197] [109960] (2 PDB entries)
    Uniprot Q9PMK9
  8. 780094Domain d2cica1: 2cic A:1-229 [130487]
    automatically matched to d1w2ya_
    complexed with dup, mg

Details for d2cica1

PDB Entry: 2cic (more details), 1.7 Å

PDB Description: the crystal structure of a complex of campylobacter jejuni dutpase with substrate analogue dupnhpp
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotide hydrolase

SCOP Domain Sequences for d2cica1:

Sequence, based on SEQRES records: (download)

>d2cica1 a.204.1.1 (A:1-229) Type II deoxyuridine triphosphatase {Campylobacter jejuni [TaxId: 197]}
mtnieilenmlklqqklndetnglnwengytkegkliswrrciymecaelidsftwkhwk
nissltnwenvrieivdiwhfilsllleeyrdknnkdfkaiatevnavsvfqdfckeeey
pnegdiygilndieliihkcsgfgfnlgellstyftlaikcglnleilyktyigknvlni
frqnngykdgsykktwngkednevlaqileqeldfdtiykkleecykka

Sequence, based on observed residues (ATOM records): (download)

>d2cica1 a.204.1.1 (A:1-229) Type II deoxyuridine triphosphatase {Campylobacter jejuni [TaxId: 197]}
mtnieilenmlklqqklndetnglnwengytkegkliswrrciymecaelidsftwkhwk
nissltnwenvrieivdiwhfilsllleeydfkaiatevnavsvfqdfckeeeypnegdi
ygilndieliihkcsgfgfnlgellstyftlaikcglnleilyktyigknvlnifrqnng
ykdgsykktwngkednevlaqileqeldfdtiykkleecykka

SCOP Domain Coordinates for d2cica1:

Click to download the PDB-style file with coordinates for d2cica1.
(The format of our PDB-style files is described here.)

Timeline for d2cica1: