SCOP 1.73: Domain d2chob3: 2cho B:5-126

Lineage for d2chob3 (2cho B:5-126)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (3 families)
   contains similar fold but lacks its catalytic centre

5. Family d.92.2.3: Hyaluronidase N-terminal domain-like [143618] (2 proteins)

6. Protein Glucosaminidase GH84, N-terminal domain [143621] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [143622] (3 PDB entries)

8. Domain d2chob3: 2cho B:5-126 [130484]
   Other proteins in same PDB: d2choa1, d2choa2, d2chob1, d2chob2
   automatically matched to 2CHN A:4-126
   complexed with act, ca, gol

Details for d2chob3

PDB Entry: 2cho, 1.85 Å

PDB Description: bacteroides thetaiotaomicron hexosaminidase with o-glcnacase activity

PDB Compounds: (B:) glucosaminidase

SCOP Domain Sequences for d2chob3:

Sequence, based on SEQRES records:

>d2chob3 d.92.2.3 (B:5-126) Glucosaminidase GH84, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
lqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisigekgd
ksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdy
ps

Sequence, based on observed residues (ATOM records):

>d2chob3 d.92.2.3 (B:5-126) Glucosaminidase GH84, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
lqpppqqlivqnktidlpavyqlnggeeanphavkvlkellgmlisigekgdksvrkysr
qipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdyps

Timeline for d2chob3:

• d2chob3 is new in SCOP 1.73
  
• d2chob3 appears in SCOP 1.75
  
• d2chob3 appears in the current release, SCOPe 2.08