SCOP 1.73: Domain d2chob2: 2cho B:127-436

Lineage for d2chob2 (2cho B:127-436)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (14 families)

5. Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (3 proteins)
   Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain

6. Protein Glucosaminidase GH84, catalytic domain [141790] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [141791] (3 PDB entries)

8. Domain d2chob2: 2cho B:127-436 [130483]
   Other proteins in same PDB: d2choa1, d2choa3, d2chob1, d2chob3
   automatically matched to 2CHN A:127-436
   complexed with act, ca, gol

Details for d2chob2

PDB Entry: 2cho, 1.85 Å

PDB Description: bacteroides thetaiotaomicron hexosaminidase with o-glcnacase activity

PDB Compounds: (B:) glucosaminidase

SCOP Domain Sequences for d2chob2:

Sequence; same for both SEQRES and ATOM records:

>d2chob2 c.1.8.10 (B:127-436) Glucosaminidase GH84, catalytic domain {Bacteroides thetaiotaomicron [TaxId: 818]}
vryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpypdkeaa
qlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavffddisg
egtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdklnpsiq
imwtgdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndttiakem
sgfvtnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecfamhns
dlgpnghgyr

Timeline for d2chob2:

• d2chob2 is new in SCOP 1.73
  
• d2chob2 appears in SCOP 1.75
  
• d2chob2 appears in the current release, SCOPe 2.08