Lineage for d2chob1 (2cho B:437-590)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651675Fold a.246: Hyaluronidase domain-like [140656] (2 superfamilies)
    5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology
  4. 651676Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (1 family) (S)
  5. 651677Family a.246.1.1: Hyaluronidase post-catalytic domain-like [140658] (2 proteins)
  6. 651678Protein Glucosaminidase GH84 post-catalytic domain [140661] (1 species)
  7. 651679Species Bacteroides thetaiotaomicron [TaxId:818] [140662] (3 PDB entries)
  8. 651681Domain d2chob1: 2cho B:437-590 [130482]
    Other proteins in same PDB: d2choa2, d2choa3, d2chob2, d2chob3
    automatically matched to 2CHN A:437-590
    complexed with act, ca, gol

Details for d2chob1

PDB Entry: 2cho (more details), 1.85 Å

PDB Description: bacteroides thetaiotaomicron hexosaminidase with o-glcnacase activity
PDB Compounds: (B:) glucosaminidase

SCOP Domain Sequences for d2chob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2chob1 a.246.1.1 (B:437-590) Glucosaminidase GH84 post-catalytic domain {Bacteroides thetaiotaomicron [TaxId: 818]}
reesmdiqpaaerflkafkegknydkadfetlqytfermkesadillmntenkpliveit
pwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidqtsnqnpyqpgvkt
atrvikplidrtfatvvkffnqkfnahldattdy

SCOP Domain Coordinates for d2chob1:

Click to download the PDB-style file with coordinates for d2chob1.
(The format of our PDB-style files is described here.)

Timeline for d2chob1: