Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (3 families) contains similar fold but lacks its catalytic centre |
Family d.92.2.3: Hyaluronidase N-terminal domain-like [143618] (2 proteins) |
Protein Glucosaminidase GH84, N-terminal domain [143621] (1 species) |
Species Bacteroides thetaiotaomicron [TaxId:818] [143622] (3 PDB entries) |
Domain d2choa3: 2cho A:5-126 [130481] Other proteins in same PDB: d2choa1, d2choa2, d2chob1, d2chob2 automatically matched to 2CHN A:4-126 complexed with act, ca, gol |
PDB Entry: 2cho (more details), 1.85 Å
SCOP Domain Sequences for d2choa3:
Sequence, based on SEQRES records: (download)
>d2choa3 d.92.2.3 (A:5-126) Glucosaminidase GH84, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} lqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisigekgd ksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdy ps
>d2choa3 d.92.2.3 (A:5-126) Glucosaminidase GH84, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} lqpppqqlivqnktidlpavyqlnggeeanphavkvlkellgmlisigekgdksvrkysr qipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdyps
Timeline for d2choa3: