SCOPe 2.07: Domain d2chnb1: 2chn B:437-590

Lineage for d2chnb1 (2chn B:437-590)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies)
   5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology

4. Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (2 families)

5. Family a.246.1.1: Hyaluronidase post-catalytic domain-like [140658] (2 proteins)

6. Protein Glucosaminidase GH84 post-catalytic domain [140661] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [140662] (8 PDB entries)
   Uniprot Q89ZI2 458-610! Uniprot Q89ZI2 458-611

8. Domain d2chnb1: 2chn B:437-590 [130476]
   Other proteins in same PDB: d2chna2, d2chna3, d2chnb2, d2chnb3
   automatically matched to 2CHN A:437-590
   complexed with ca, gol, ngt

Details for d2chnb1

PDB Entry: 2chn, 1.95 Å

PDB Description: bacteroides thetaiotaomicron hexosaminidase with o-glcnacase activity- nag-thiazoline complex

PDB Compounds: (B:) glucosaminidase

SCOPe Domain Sequences for d2chnb1:

Sequence; same for both SEQRES and ATOM records:

>d2chnb1 a.246.1.1 (B:437-590) Glucosaminidase GH84 post-catalytic domain {Bacteroides thetaiotaomicron [TaxId: 818]}
reesmdiqpaaerflkafkegknydkadfetlqytfermkesadillmntenkpliveit
pwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidqtsnqnpyqpgvkt
atrvikplidrtfatvvkffnqkfnahldattdy

Timeline for d2chnb1:

• d2chnb1 first appeared in SCOP 1.73
  
• d2chnb1 appears in SCOPe 2.06
  
• d2chnb1 appears in the current release, SCOPe 2.08