Class a: All alpha proteins [46456] (258 folds) |
Fold a.246: Hyaluronidase domain-like [140656] (2 superfamilies) 5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology |
Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (1 family) |
Family a.246.1.1: Hyaluronidase post-catalytic domain-like [140658] (2 proteins) |
Protein Glucosaminidase GH84 post-catalytic domain [140661] (1 species) |
Species Bacteroides thetaiotaomicron [TaxId:818] [140662] (3 PDB entries) |
Domain d2chnb1: 2chn B:437-590 [130476] Other proteins in same PDB: d2chna2, d2chna3, d2chnb2, d2chnb3 automatically matched to 2CHN A:437-590 complexed with ca, gol, ngt |
PDB Entry: 2chn (more details), 1.95 Å
SCOP Domain Sequences for d2chnb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2chnb1 a.246.1.1 (B:437-590) Glucosaminidase GH84 post-catalytic domain {Bacteroides thetaiotaomicron [TaxId: 818]} reesmdiqpaaerflkafkegknydkadfetlqytfermkesadillmntenkpliveit pwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidqtsnqnpyqpgvkt atrvikplidrtfatvvkffnqkfnahldattdy
Timeline for d2chnb1: