SCOPe 2.06: Domain d2chma1: 2chm A:537-858

Lineage for d2chma1 (2chm A:537-858)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein cGMP-specific 3',5'-cyclic phosphodiesterase pde5a1-Ibmx [101439] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101440] (19 PDB entries)
   Uniprot O76074 534-860

8. Domain d2chma1: 2chm A:537-858 [130472]
   complexed with 3p4, mes, mg, zn

Details for d2chma1

PDB Entry: 2chm, 1.6 Å

PDB Description: crystal structure of n2 substituted pyrazolo pyrimidinones - a flipped binding mode in pde5

PDB Compounds: (A:) cgmp-specific 3', 5'-cyclic phosphodiesterase, camp-specific 3', 5'-cyclic phosphodiesterase 4b

SCOPe Domain Sequences for d2chma1:

Sequence; same for both SEQRES and ATOM records:

>d2chma1 a.211.1.2 (A:537-858) cGMP-specific 3',5'-cyclic phosphodiesterase pde5a1-Ibmx {Human (Homo sapiens) [TaxId: 9606]}
trelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhevlc
rwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshdld
hpgvsnqflintnselalmyndesvlehhhfdqclmilnspgnqilsglsieeykttlki
ikqailatdlalyikrrgeffelirknqfnledphekelflamlmtacdlsaitkpwpiq
qriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyealthv
sedcfplldgcrknrqkwqalae

Timeline for d2chma1:

• d2chma1 first appeared in SCOP 1.73
  
• d2chma1 appears in SCOPe 2.05
  
• d2chma1 appears in SCOPe 2.07
  
• d2chma1 appears in the current release, SCOPe 2.08