| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.5: BadF/BadG/BcrA/BcrD-like [64089] (5 proteins) |
| Protein N-acetylglucosamine kinase, NAGK [142458] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [142459] (2 PDB entries) Uniprot Q9UJ70 1-117! Uniprot Q9UJ70 118-344 |
| Domain d2ch6a2: 2ch6 A:2-117 [130462] automated match to d2ch5a2 complexed with adp, glc |
PDB Entry: 2ch6 (more details), 2.72 Å
SCOPe Domain Sequences for d2ch6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ch6a2 c.55.1.5 (A:2-117) N-acetylglucosamine kinase, NAGK {Human (Homo sapiens) [TaxId: 9606]}
aaiyggvegggtrsevllvsedgkilaeadglstnhwligtdkcverinemvnrakrkag
vdplvplrslglslsggdqedagrilieelrdrfpylsesylittdaagsiatatp
Timeline for d2ch6a2: