Lineage for d2ch5a2 (2ch5 A:1-117)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701285Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families) (S)
    duplication contains two domains of this fold
  5. 701705Family c.55.1.5: BadF/BadG/BcrA/BcrD-like [64089] (5 proteins)
  6. 701728Protein N-acetylglucosamine kinase, NAGK [142458] (1 species)
  7. 701729Species Human (Homo sapiens) [TaxId:9606] [142459] (2 PDB entries)
  8. 701731Domain d2ch5a2: 2ch5 A:1-117 [130454]
    complexed with gol, nag, ndg

Details for d2ch5a2

PDB Entry: 2ch5 (more details), 1.9 Å

PDB Description: crystal structure of human n-acetylglucosamine kinase in complex with n-acetylglucosamine
PDB Compounds: (A:) nagk protein

SCOP Domain Sequences for d2ch5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ch5a2 c.55.1.5 (A:1-117) N-acetylglucosamine kinase, NAGK {Human (Homo sapiens) [TaxId: 9606]}
maaiyggvegggtrsevllvsedgkilaeadglstnhwligtdkcverinemvnrakrka
gvdplvplrslglslsggdqedagrilieelrdrfpylsesylittdaagsiatatp

SCOP Domain Coordinates for d2ch5a2:

Click to download the PDB-style file with coordinates for d2ch5a2.
(The format of our PDB-style files is described here.)

Timeline for d2ch5a2: