Lineage for d2cfga1 (2cfg A:212-627)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 664384Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 664385Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
  5. 664386Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins)
  6. 664387Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 664388Species Arthrobacter globiformis [TaxId:1665] [50003] (34 PDB entries)
  8. 664421Domain d2cfga1: 2cfg A:212-627 [130376]
    Other proteins in same PDB: d2cfga2, d2cfga3, d2cfgb2, d2cfgb3
    automatically matched to d1av4_1
    complexed with cu, gol, na, r4a, so4

Details for d2cfga1

PDB Entry: 2cfg (more details), 1.55 Å

PDB Description: agao in complex with wc4d3 (ru-wire inhibitor, 4-carbon linker, delta enantiomer, data set 3)
PDB Compounds: (A:) phenylethylamine oxidase

SCOP Domain Sequences for d2cfga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cfga1 b.30.2.1 (A:212-627) Copper amine oxidase, domain 3 {Arthrobacter globiformis [TaxId: 1665]}
plrttqkpisitqpegpsftvtggnhiewekwsldvgfdvregvvlhniafrdgdrlrpi
inrasiaemvvpygdpspirswqnyfdtgeylvgqyanslelgcdclgditylspvisda
fgnpreirngicmheedwgilakhsdlwsginytrrnrrmvisffttignydygfywyly
ldgtiefeakatgvvftsafpeggsdnisqlapglgapfhqhifsarldmaidgftnrve
eedvvrqtmgpgnergnafsrkrtvltreseavreadartgrtwiisnpesknrlnepvg
yklhahnqptlladpgssiarraafatkdlwvtryadderyptgdfvnqhsggaglpsyi
aqdrdidgqdivvwhtfglthfprvedwpimpvdtvgfklrpegffdrspvldvpa

SCOP Domain Coordinates for d2cfga1:

Click to download the PDB-style file with coordinates for d2cfga1.
(The format of our PDB-style files is described here.)

Timeline for d2cfga1: