Lineage for d2cf2c1 (2cf2 C:2001-2171)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187707Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2187708Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2187851Family d.38.1.2: beta-Hydroxydecanol thiol ester dehydrase [54641] (2 proteins)
    contains two additional beta-strands in the N-terminal extension
  6. 2187852Protein beta-Hydroxydecanol thiol ester dehydrase [54642] (1 species)
  7. 2187853Species Escherichia coli [TaxId:562] [54643] (4 PDB entries)
  8. 2187860Domain d2cf2c1: 2cf2 C:2001-2171 [130362]
    Other proteins in same PDB: d2cf2a1, d2cf2a2, d2cf2e1, d2cf2j1, d2cf2j2, d2cf2n1
    automatically matched to d1mkaa_

Details for d2cf2c1

PDB Entry: 2cf2 (more details), 4.3 Å

PDB Description: architecture of mammalian fatty acid synthase
PDB Compounds: (C:) fatty acid synthase, dh domain

SCOPe Domain Sequences for d2cf2c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cf2c1 d.38.1.2 (C:2001-2171) beta-Hydroxydecanol thiol ester dehydrase {Escherichia coli [TaxId: 562]}
vdkresytkedllasgrgelfgakgpqlpapnmlmmdrvvkmtetggnfdkgyveaeldi
npdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgqvlpt
akkvtyrihfkrivnrrlimgladgevlvdgrliytasdlkvglfqdtsaf

SCOPe Domain Coordinates for d2cf2c1:

Click to download the PDB-style file with coordinates for d2cf2c1.
(The format of our PDB-style files is described here.)

Timeline for d2cf2c1: