Lineage for d2ceia_ (2cei A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1727564Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1727565Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1728504Protein automated matches [190041] (24 species)
    not a true protein
  7. 1728753Species Human (Homo sapiens) [TaxId:9606] [187027] (19 PDB entries)
  8. 1728760Domain d2ceia_: 2cei A: [130344]
    automated match to d1fha__
    complexed with zn; mutant

Details for d2ceia_

PDB Entry: 2cei (more details), 1.8 Å

PDB Description: recombinant human h ferritin, k86q mutant, soaked with zn
PDB Compounds: (A:) ferritin heavy chain

SCOPe Domain Sequences for d2ceia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ceia_ a.25.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere
haeklmklqnqrggriflqdiqkpdcddwesglnamecalhleknvnqsllelhklatdk
ndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg

SCOPe Domain Coordinates for d2ceia_:

Click to download the PDB-style file with coordinates for d2ceia_.
(The format of our PDB-style files is described here.)

Timeline for d2ceia_: