Lineage for d2ceia1 (2cei A:5-176)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 638518Fold a.25: Ferritin-like [47239] (4 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 638519Superfamily a.25.1: Ferritin-like [47240] (5 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 638520Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 638521Protein (Apo)ferritin [47246] (7 species)
  7. 638595Species Human (Homo sapiens), H chain [TaxId:9606] [47247] (3 PDB entries)
  8. 638596Domain d2ceia1: 2cei A:5-176 [130344]
    automatically matched to d1fha__
    complexed with zn; mutant

Details for d2ceia1

PDB Entry: 2cei (more details), 1.8 Å

PDB Description: recombinant human h ferritin, k86q mutant, soaked with zn
PDB Compounds: (A:) ferritin heavy chain

SCOP Domain Sequences for d2ceia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ceia1 a.25.1.1 (A:5-176) (Apo)ferritin {Human (Homo sapiens), H chain [TaxId: 9606]}
tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere
haeklmklqnqrggriflqdiqkpdcddwesglnamecalhleknvnqsllelhklatdk
ndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg

SCOP Domain Coordinates for d2ceia1:

Click to download the PDB-style file with coordinates for d2ceia1.
(The format of our PDB-style files is described here.)

Timeline for d2ceia1: